Publication to reference in reporting results: ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ Rost, Burkhard; Sander, Chris: Prediction of protein structure at better than 70% accuracy. J. Mol. Biol., 1993, 232, 584-599. Rost, Burkhard; Sander, Chris: Combining evolutionary information and neural networks to predict protein secondary structure. Proteins, 1994, 19 (No. 1), 55-72. Rost, Burkhard; Sander, Chris: Conservation and Prediction of Solvent Accessibility in Protein Families. Proteins, 1994, in press. Some statistics: ~~~~~~~~~~~~~~~~ Percentage of amino acids: +--------------+--------+--------+--------+--------+--------+ | AA: | G | P | S | Q | V | | % of AA: | 17.8 | 6.7 | 5.9 | 5.9 | 5.5 | +--------------+--------+--------+--------+--------+--------+ | AA: | Y | T | N | M | L | | % of AA: | 5.1 | 5.1 | 4.7 | 4.7 | 4.7 | +--------------+--------+--------+--------+--------+--------+ | AA: | R | K | H | A | W | | % of AA: | 4.3 | 4.0 | 4.0 | 4.0 | 3.6 | +--------------+--------+--------+--------+--------+--------+ | AA: | I | E | F | D | C | | % of AA: | 3.6 | 3.6 | 2.8 | 2.4 | 1.6 | +--------------+--------+--------+--------+--------+--------+ Percentage of secondary structure predicted: +--------------+--------+--------+--------+ | SecStr: | H | E | L | | % Predicted: | 10.7 | 18.2 | 71.1 | +--------------+--------+--------+--------+ According to the following classes: all-alpha: %H>45 and %E< 5; all-beta : %H<5 and %E>45 alpha-beta : %H>30 and %E>20; mixed: rest, this means that the predicted class is: mixed class PHD output for your protein: ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ Fri Jun 10 15:18:27 1994 For secondary structure prediction: Jury on: 10 different architectures (version 5.94 ). For solvent accessibility prediction: Jury on: 5 different architectures (version 5.94 ). Note: differently trained architectures, i.e., different versions can result in different predictions. About the protein: ------------------ HEADER prio_human.gcg COMPND SOURCE AUTHOR SEQLENGTH 253 NCHAIN 1 chain(s) in prio_human data set NALIGN 48 (=number of aligned sequences in HSSP file) Abbreviations: -------------- secondary structure : H=helix, E=extended (sheet), blank=rest (loop) accessibility : 3st: relative solvent accessibility (acc) in 3 states: b = 0-9%, i = 9-36%, e = 36-100%. 10st: relative solvent acc. in 10 states = n corresponds to a relative acc. of n*n % AA: amino acid sequence OBS: values for experimentally observed 3D structures OBS sec: DSSP classification of secondary structure OBS acc: DSSP estimat of relative solvent accessibility area O_3 acc: observed relative accessibility in 3 states: B, I, E Note: a blank is used for intermediate (i) PHD: Profile network prediction HeiDelberg PHD sec: prediction of secondary structure in three states PHD acc: prediction of solvent accessibility in 10 states P_3 acc: predicted relative accessibility in 3 states Rel: Reliability index of prediction (0-9) Rel sec: reliability of secondary structure prediction Rel sec: reliability of accessibility prediction detail: prH sec: 'probability' for assigning helix prE sec: 'probability' for assigning strand prL:sec: 'probability' for assigning loop Note: the 'probabilites' are scaled to the interval 0-9, i.e. prH=5 means, that the signal at the first output node is 0.5-0.6. subset: SUB: a subset of the prediction, for all residues with a reliablity > n, with the following choices: SUB sec: for secondary structure prediction n >= 5, which corresponds to an expected accuracy > 82% (see tables in header) note: for this subset the following symbols are used: L: is loop (for which above " " is used) ".": means that no prediction is made for this residue, as the reliability is Rel < 5 SUB acc: for accessibility prediction n >= 4, which corresponds to an expected correlation coefficient > 0.69% (see tables in header) Note: for this subset the following symbols are used: "I": is intermediate (for which above " " is used) ".": means that no prediction is made for this residue, as the reliability is Rel < 4 protein: prio length 253 ....,....1....,....2....,....3....,....4....,....5....,....6 AA |MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP| PHD sec | EEEEEEEEEEE | Rel sec |983211699899885157889998887788556886678877647677876567766654| detail: prH sec |001222000000000000000000111101222111111111221211111221111122 prE sec |002334788888886421000000000000000000000000000000000000000000 prL sec |985443100000012477888998888888767887778888767788877777777776 subset: SUB sec |LL....EEEEEEEEE.LLLLLLLLLLLLLLLLLLLLLLLLLLL.LLLLLLLLLLLLLLL.| ACC: 3st: P_3 acc |eeebbbbbbbbbbbbbbeee eeeeeeeeb e bbe ebeb eebee eeeb b b b| 10st: PHD acc |967000000000000007665667666860565006556060566066558860505030 Rel acc |515413599998742104212224102410211002222021211021113311102200 subset: SUB acc |e.eb..bbbbbbbb...e.....e...e................................| ....,....7....,....8....,....9....,....10...,....11...,....1 AA |HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA| PHD sec | | Rel sec |556543545687444567754445787553244453568899998789887566545676| detail: prH sec |221233222111222221123222111223433323220000000110011211222111 prE sec |000000000000000000000000000000000000000000000000000010000000 prL sec |777666666787666677766666788765566666678899998888887777767787 subset: SUB sec |LLLL..L.LLLL...LLLLL...LLLLLL.....L.LLLLLLLLLLLLLLLLLLL.LLLL| ACC: 3st: P_3 acc | b b b b b b b e bbb b e bb b bbbe eeeeeeeeeee eebbbbbbbbb| 10st: PHD acc |505050505050305630005036500530500065366668766676366000000000 Rel acc |221223201010001101012301110103101122021124411141022103331222 ACC: 2...,....13...,....14...,....15...,....16...,....17...,....1 AA |VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV| PHD sec | EEEE EEEEEE| Rel sec |567755311344445665677778778555587455899355432765678995554168| detail: prH sec |111122344322332111110011111111001210000000000112110000000000 prE sec |100000000010000012111000000122210122100367664101100002676578 prL sec |777766544566666776678878878766687666888522335776678997223421 subset: SUB sec |LLLLLL........LLLLLLLLLLLLLLLLLLL.LLLLL.EE...LLLLLLLLLEE..EE| ACC: 3st: P_3 acc | bbb bb bbbeb beb bebb e eeebbeebb bbe bbb bbee eeeeebbbbbb| 10st: PHD acc |500050050006050605060057566600670055206500040066567666000000 Rel acc |113211521142021301020224222200241123321241130034233203342299 ACC: 8...,....19...,....20...,....21...,....22...,....23...,....2 AA |NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV| PHD sec |EEEEEEEEEEE HHHHHHHHHHHHHHHHHHHHHHHHHHH EEEEE E| Rel sec |999988588653788762115688999999998698996699986179974688829967| detail: prH sec |000000000000000000136788999999998788897799987410000000000000 prE sec |999988688773110123320000000000000000000000001100016788840018 prL sec |000011311225888875432200000000000100002200001489973110059971 subset: SUB sec |EEEEEEEEEEE.LLLLL...HHHHHHHHHHHHHHHHHHHHHHHHH.LLLL.EEEE.LLLE| ACC: 3st: P_3 acc |bbbbee bbeeeeeeee eeebbebbe bbebbbbbbbeeeeeb eeeebbbbbebbbb| 10st: PHD acc |000066300666667675766006007500700000006766605577860000080000 Rel acc |375942003323347172543014675499729930014933505286621233540006 subset: SUB acc |.bbbe........ee.e.ee...ebbeibbe.bb....ee..e.i.eee.....be...b| 4...,....25...,....26...,....27...,....28...,....29...,....3 AA |ILLISFLIFLIVG| PHD sec |EEEE EEEE | Rel sec |8885111124529 detail: prH sec |0012344432100 prE sec |8886212456650 prL sec |0001443100139 subset: SUB sec |EEEE......E.L| ACC: 3st: P_3 acc |bbbbbbbbbbb e| 10st: PHD acc |0000000000059 Rel acc |9999699896229 subset: SUB acc |bbbbbbbbbb..e|